Lineage for d3quxa2 (3qux A:186-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1764014Domain d3quxa2: 3qux A:186-279 [200393]
    Other proteins in same PDB: d3quxa1, d3quxb_, d3quxc1, d3quxd1, d3quxd2
    automated match to d1onqa1
    complexed with nag, qux

Details for d3quxa2

PDB Entry: 3qux (more details), 2.91 Å

PDB Description: structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3quxa2:

Sequence, based on SEQRES records: (download)

>d3quxa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3quxa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3quxa2:

Click to download the PDB-style file with coordinates for d3quxa2.
(The format of our PDB-style files is described here.)

Timeline for d3quxa2: