Lineage for d1lmke2 (1lmk E:201-312)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52742Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry)
  8. 52748Domain d1lmke2: 1lmk E:201-312 [20039]

Details for d1lmke2

PDB Entry: 1lmk (more details), 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmke2 b.1.1.1 (E:201-312) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain}
dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk

SCOP Domain Coordinates for d1lmke2:

Click to download the PDB-style file with coordinates for d1lmke2.
(The format of our PDB-style files is described here.)

Timeline for d1lmke2: