Lineage for d3quib_ (3qui B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1313020Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 1313021Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 1313029Species Pseudomonas aeruginosa [TaxId:287] [141293] (9 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 1313067Domain d3quib_: 3qui B: [200388]
    automated match to d1u1te_
    protein/RNA complex; complexed with ade, adp, anp, peg

Details for d3quib_

PDB Entry: 3qui (more details), 1.93 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa Hfq in complex with ADPNP
PDB Compounds: (B:) Protein hfq

SCOPe Domain Sequences for d3quib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quib_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
psrpvrl

SCOPe Domain Coordinates for d3quib_:

Click to download the PDB-style file with coordinates for d3quib_.
(The format of our PDB-style files is described here.)

Timeline for d3quib_: