Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries) |
Domain d3qsuk_: 3qsu K: [200383] automated match to d1kq1b_ protein/RNA complex; complexed with zn |
PDB Entry: 3qsu (more details), 2.2 Å
SCOPe Domain Sequences for d3qsuk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qsuk_ b.38.1.2 (K:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv e
Timeline for d3qsuk_: