Lineage for d3qrdb_ (3qrd B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161469Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2161502Family d.17.1.2: Cystatins [54407] (7 protein domains)
    automatically mapped to Pfam PF00031
  6. 2161536Protein Cystatin C [64231] (1 species)
  7. 2161537Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
    Uniprot P01034 37-146
  8. 2161552Domain d3qrdb_: 3qrd B: [200371]
    automated match to d3ps8a_
    complexed with peg; mutant

Details for d3qrdb_

PDB Entry: 3qrd (more details), 2.19 Å

PDB Description: Crystal structure of L68V mutant of human cystatin C
PDB Compounds: (B:) Cystatin-C

SCOPe Domain Sequences for d3qrdb_:

Sequence, based on SEQRES records: (download)

>d3qrdb_ d.17.1.2 (B:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvevgrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Sequence, based on observed residues (ATOM records): (download)

>d3qrdb_ d.17.1.2 (B:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvevgrt
tctktqpnldncpfhkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d3qrdb_:

Click to download the PDB-style file with coordinates for d3qrdb_.
(The format of our PDB-style files is described here.)

Timeline for d3qrdb_: