Lineage for d3qp3a1 (3qp3 A:2-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753922Protein Titin [49172] (1 species)
  7. 2753923Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries)
  8. 2753924Domain d3qp3a1: 3qp3 A:2-101 [200366]
    Other proteins in same PDB: d3qp3a2, d3qp3b2
    automated match to d3qp3c_
    complexed with so4

Details for d3qp3a1

PDB Entry: 3qp3 (more details), 2 Å

PDB Description: Crystal structure of titin domain M4, tetragonal form
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d3qp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qp3a1 b.1.1.4 (A:2-101) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
pftldhapritlrmrshrvpcgqntrfilnvqskptaevkwyhngvelqesskihytnts
gvltleildchtddsgtyravctnykgeasdyatldvtgg

SCOPe Domain Coordinates for d3qp3a1:

Click to download the PDB-style file with coordinates for d3qp3a1.
(The format of our PDB-style files is described here.)

Timeline for d3qp3a1: