SCOP 1.69: Domain d1lmkc1: 1lmk C:2-127

Lineage for d1lmkc1 (1lmk C:2-127)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1lmkc1: 1lmk C:2-127 [20036]
   Other proteins in same PDB: d1lmka2, d1lmkc2, d1lmke2, d1lmkg2

Details for d1lmkc1

PDB Entry: 1lmk, 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmkc1:

Sequence; same for both SEQRES and ATOM records:

>d1lmkc1 b.1.1.1 (C:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
sggggs

Timeline for d1lmkc1:

• d1lmkc1 first appeared (with stable ids) in SCOP 1.55
  
• d1lmkc1 appears in SCOP 1.67
  
• d1lmkc1 appears in SCOP 1.71
  
• d1lmkc1 appears in the current release, SCOPe 2.08