![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
![]() | Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries) |
![]() | Domain d3qipa2: 3qip A:430-556 [200353] Other proteins in same PDB: d3qipa1, d3qipb_ automated match to d1c1ba1 complexed with cl, mn, nvp, p4y, so4 |
PDB Entry: 3qip (more details), 2.09 Å
SCOPe Domain Sequences for d3qipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qipa2 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagi
Timeline for d3qipa2: