![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (628 PDB entries) |
![]() | Domain d3qi9d2: 3qi9 D:119-243 [200351] Other proteins in same PDB: d3qi9a1, d3qi9a2, d3qi9a3, d3qi9b_, d3qi9c1, d3qi9d1 automated match to d1ktke2 complexed with gol, mg, nag, pii |
PDB Entry: 3qi9 (more details), 2.3 Å
SCOPe Domain Sequences for d3qi9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qi9d2 b.1.1.2 (D:119-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]} alknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeaw
Timeline for d3qi9d2: