Lineage for d3qi9d1 (3qi9 D:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760107Domain d3qi9d1: 3qi9 D:1-118 [200350]
    Other proteins in same PDB: d3qi9a1, d3qi9a2, d3qi9a3, d3qi9b_, d3qi9c2, d3qi9d2
    automated match to d1ktke1
    complexed with gol, mg, nag, pii

Details for d3qi9d1

PDB Entry: 3qi9 (more details), 2.3 Å

PDB Description: crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
PDB Compounds: (D:) NKT TCR V beta 6 2A3-D

SCOPe Domain Sequences for d3qi9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qi9d1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggiitqtpkfligqegqkltlkcqqnfnhdtmywyrqdsgkglrliyysygagstekgdl
segydasrekkssfsltvtsaqknemavflcasgslldvrevffgkgtrltvve

SCOPe Domain Coordinates for d3qi9d1:

Click to download the PDB-style file with coordinates for d3qi9d1.
(The format of our PDB-style files is described here.)

Timeline for d3qi9d1: