![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (776 PDB entries) |
![]() | Domain d3qi9c1: 3qi9 C:1-117 [200348] Other proteins in same PDB: d3qi9a1, d3qi9a2, d3qi9a3, d3qi9b_, d3qi9c2, d3qi9d2 automated match to d1qrnd1 complexed with gol, mg, nag, pii |
PDB Entry: 3qi9 (more details), 2.3 Å
SCOPe Domain Sequences for d3qi9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qi9c1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d3qi9c1: