Lineage for d3qi9a1 (3qi9 A:6-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937606Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2937619Domain d3qi9a1: 3qi9 A:6-185 [200346]
    Other proteins in same PDB: d3qi9a2, d3qi9a3, d3qi9b_, d3qi9c1, d3qi9c2, d3qi9d1, d3qi9d2
    automated match to d1gzpa2
    complexed with gol, mg, nag, pii

Details for d3qi9a1

PDB Entry: 3qi9 (more details), 2.3 Å

PDB Description: crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3qi9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qi9a1 d.19.1.1 (A:6-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3qi9a1:

Click to download the PDB-style file with coordinates for d3qi9a1.
(The format of our PDB-style files is described here.)

Timeline for d3qi9a1: