Lineage for d1lmka1 (1lmk A:2-127)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8036Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry)
  8. 8037Domain d1lmka1: 1lmk A:2-127 [20034]

Details for d1lmka1

PDB Entry: 1lmk (more details), 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain}
vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
sggggs

SCOP Domain Coordinates for d1lmka1:

Click to download the PDB-style file with coordinates for d1lmka1.
(The format of our PDB-style files is described here.)

Timeline for d1lmka1: