SCOPe 2.08: Domain d3qfoa_: 3qfo A:

Lineage for d3qfoa_ (3qfo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.0: automated matches [191347] (1 protein)
   not a true family

6. Protein automated matches [190255] (6 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [196217] (3 PDB entries)

8. Domain d3qfoa_: 3qfo A: [200339]
   automated match to d3qfob_
   complexed with amp, fe, mn

Details for d3qfoa_

PDB Entry: 3qfo, 2.2 Å

PDB Description: Crystal structure of Streptococcal asymmetric Ap4A hydrolase and phosphodiesterase Spr1479/SapH im complex with AMP

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3qfoa_:

Sequence; same for both SEQRES and ATOM records:

>d3qfoa_ d.159.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mtkiallsdihgnttaleavladarqlgvdeywllgdilmpgtgrrrildlldqlpitar
vlgnwedslwhgvrkeldstrpsqryllrqcqyvleeisleeievlhnqplqihrqfgdl
tvgishhlpdknwgrelihtgkqeefdrlvthppcdiavyghihqqllrygtggqlivnp
gsigqpffldaqlrkdlraqymilefddkglvdmdfrrvdydvaaelqlakdlrlpyfev
yyeslvngih

Timeline for d3qfoa_:

• d3qfoa_ first appeared in SCOPe 2.03
  
• d3qfoa_ appears in SCOPe 2.07