SCOPe 2.06: Domain d3qfje1: 3qfj E:1-117

Lineage for d3qfje1 (3qfj E:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3qfje1: 3qfj E:1-117 [200337]
   Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd1, d3qfjd2, d3qfje2
   automated match to d1ktke1
   complexed with gol

Details for d3qfje1

PDB Entry: 3qfj, 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide

PDB Compounds: (E:) A6 beta chain

SCOPe Domain Sequences for d3qfje1:

Sequence; same for both SEQRES and ATOM records:

>d3qfje1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

Timeline for d3qfje1:

• d3qfje1 first appeared in SCOPe 2.03
  
• d3qfje1 appears in SCOPe 2.05
  
• d3qfje1 appears in SCOPe 2.07
  
• d3qfje1 appears in the current release, SCOPe 2.08