Lineage for d3qfje1 (3qfj E:1-117)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765676Domain d3qfje1: 3qfj E:1-117 [200337]
    Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb_, d3qfjd1, d3qfjd2, d3qfje2
    automated match to d1ktke1
    complexed with gol

Details for d3qfje1

PDB Entry: 3qfj (more details), 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide
PDB Compounds: (E:) A6 beta chain

SCOPe Domain Sequences for d3qfje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfje1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

SCOPe Domain Coordinates for d3qfje1:

Click to download the PDB-style file with coordinates for d3qfje1.
(The format of our PDB-style files is described here.)

Timeline for d3qfje1: