Lineage for d3qfje1 (3qfj E:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755662Domain d3qfje1: 3qfj E:1-117 [200337]
    Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd1, d3qfjd2, d3qfje2
    automated match to d1ktke1
    complexed with gol

Details for d3qfje1

PDB Entry: 3qfj (more details), 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide
PDB Compounds: (E:) A6 beta chain

SCOPe Domain Sequences for d3qfje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfje1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

SCOPe Domain Coordinates for d3qfje1:

Click to download the PDB-style file with coordinates for d3qfje1.
(The format of our PDB-style files is described here.)

Timeline for d3qfje1: