| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
| Domain d3qfjd2: 3qfj D:118-206 [200336] Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd1, d3qfje1, d3qfje2 automated match to d1qsed2 complexed with gol missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3qfj (more details), 2.29 Å
SCOPe Domain Sequences for d3qfjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfjd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
Timeline for d3qfjd2: