Lineage for d3qfjd1 (3qfj D:1-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023719Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2023725Domain d3qfjd1: 3qfj D:1-117 [200335]
    Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd2, d3qfje1, d3qfje2
    automated match to d1qsed1
    complexed with gol

Details for d3qfjd1

PDB Entry: 3qfj (more details), 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide
PDB Compounds: (D:) A6 alpha chain

SCOPe Domain Sequences for d3qfjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfjd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d3qfjd1:

Click to download the PDB-style file with coordinates for d3qfjd1.
(The format of our PDB-style files is described here.)

Timeline for d3qfjd1: