SCOP 1.75: Domain d1ikfh1: 1ikf H:1-126

Lineage for d1ikfh1 (1ikf H:1-126)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (54 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1ikfh1: 1ikf H:1-126 [20033]
   Other proteins in same PDB: d1ikfh2, d1ikfl1, d1ikfl2
   part of an anti-cyclosporin A Fab
   complexed with aba

Details for d1ikfh1

PDB Entry: 1ikf, 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex

PDB Compounds: (H:) igg1-kappa r45-45-11 fab (heavy chain)

SCOP Domain Sequences for d1ikfh1:

Sequence; same for both SEQRES and ATOM records:

>d1ikfh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklvesggglvqpggslklscatsgftfsdyymywvrqnsekrlewvafisngggsafy
adivkgrftisrdnakntlylqmsrlksedtamyyctrhtlydtlygnypvwfadwgqgt
lvtvsa

Timeline for d1ikfh1:

• d1ikfh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ikfh1 appears in SCOP 1.73
  
• d1ikfh1 appears in SCOPe 2.01
  
• d1ikfh1 appears in the current release, SCOPe 2.08