| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries) |
| Domain d3qfbc1: 3qfb C:2-105 [200328] Other proteins in same PDB: d3qfbc2, d3qfbd2 automated match to d3qfbd_ complexed with fad, gol |
PDB Entry: 3qfb (more details), 2.6 Å
SCOPe Domain Sequences for d3qfbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfbc1 c.47.1.1 (C:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvdd
cqdvasecevksmptfqffkkgqkvgefsgankekleatinelv
Timeline for d3qfbc1: