SCOPe 2.07: Domain d3qeqe2: 3qeq E:115-243

Lineage for d3qeqe2 (3qeq E:115-243)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3qeqe2: 3qeq E:115-243 [200326]
   Other proteins in same PDB: d3qeqa1, d3qeqa2, d3qeqb1, d3qeqb2, d3qeqd2
   automated match to d1lp9f2

Details for d3qeqe2

PDB Entry: 3qeq, 2.59 Å

PDB Description: the complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(27-35) nonameric peptide

PDB Compounds: (E:) DMF4 beta chain

SCOPe Domain Sequences for d3qeqe2:

Sequence; same for both SEQRES and ATOM records:

>d3qeqe2 b.1.1.0 (E:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3qeqe2:

• d3qeqe2 first appeared in SCOPe 2.03
  
• d3qeqe2 appears in SCOPe 2.06
  
• d3qeqe2 appears in the current release, SCOPe 2.08