Lineage for d3qeqe1 (3qeq E:1-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758444Domain d3qeqe1: 3qeq E:1-114 [200325]
    Other proteins in same PDB: d3qeqa1, d3qeqa2, d3qeqb1, d3qeqb2, d3qeqd2
    automated match to d1lp9f1

Details for d3qeqe1

PDB Entry: 3qeq (more details), 2.59 Å

PDB Description: the complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(27-35) nonameric peptide
PDB Compounds: (E:) DMF4 beta chain

SCOPe Domain Sequences for d3qeqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeqe1 b.1.1.0 (E:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dagitqsprhkvtetgtpvtlrchqtenhrymywyrqdpghglrlihysygvkdtdkgev
sdgysvsrsktedflltlesatssqtsvyfcaisevgvgqpqhfgdgtrlsile

SCOPe Domain Coordinates for d3qeqe1:

Click to download the PDB-style file with coordinates for d3qeqe1.
(The format of our PDB-style files is described here.)

Timeline for d3qeqe1: