SCOPe 2.07: Domain d3qeqa1: 3qeq A:1-181

Lineage for d3qeqa1 (3qeq A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
   Uniprot P01892 25-298

8. Domain d3qeqa1: 3qeq A:1-181 [200321]
   Other proteins in same PDB: d3qeqa2, d3qeqb1, d3qeqb2, d3qeqd1, d3qeqd2, d3qeqe1, d3qeqe2
   automated match to d1i4fa2

Details for d3qeqa1

PDB Entry: 3qeq, 2.59 Å

PDB Description: the complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(27-35) nonameric peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3qeqa1:

Sequence; same for both SEQRES and ATOM records:

>d3qeqa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3qeqa1:

• d3qeqa1 first appeared in SCOPe 2.03
  
• d3qeqa1 appears in SCOPe 2.06
  
• d3qeqa1 appears in the current release, SCOPe 2.08