Lineage for d3qeqa1 (3qeq A:1-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163098Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2163125Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
    Uniprot P01892 25-298
  8. 2163232Domain d3qeqa1: 3qeq A:1-181 [200321]
    Other proteins in same PDB: d3qeqa2, d3qeqb1, d3qeqb2, d3qeqd1, d3qeqd2, d3qeqe1, d3qeqe2
    automated match to d1i4fa2

Details for d3qeqa1

PDB Entry: 3qeq (more details), 2.59 Å

PDB Description: the complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(27-35) nonameric peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3qeqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeqa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3qeqa1:

Click to download the PDB-style file with coordinates for d3qeqa1.
(The format of our PDB-style files is described here.)

Timeline for d3qeqa1: