Lineage for d1ikfl1 (1ikf L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653619Domain d1ikfl1: 1ikf L:1-107 [20032]
    Other proteins in same PDB: d1ikfh1, d1ikfh2, d1ikfl2
    part of an anti-cyclosporin A Fab
    complexed with aba

Details for d1ikfl1

PDB Entry: 1ikf (more details), 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
PDB Compounds: (L:) igg1-kappa r45-45-11 fab (light chain)

SCOP Domain Sequences for d1ikfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikfl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdistylnwyqqkpdgtvkllifytsrlrsgvps
rfsgsgsgtdysltisnleqediatyfcqqgsripptfgggtkleil

SCOP Domain Coordinates for d1ikfl1:

Click to download the PDB-style file with coordinates for d1ikfl1.
(The format of our PDB-style files is described here.)

Timeline for d1ikfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikfl2