Lineage for d1ikfl1 (1ikf L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7873Species Fab, anti-cyclosporin A, (mouse), kappa L chain [48798] (1 PDB entry)
  8. 7875Domain d1ikfl1: 1ikf L:1-107 [20032]
    Other proteins in same PDB: d1ikfh2, d1ikfl2

Details for d1ikfl1

PDB Entry: 1ikf (more details), 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
PDB Compounds: (L:)

SCOP Domain Sequences for d1ikfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab, anti-cyclosporin A, (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscrasqdistylnwyqqkpdgtvkllifytsrlrsgvps
rfsgsgsgtdysltisnleqediatyfcqqgsripptfgggtkleil

SCOP Domain Coordinates for d1ikfl1:

Click to download the PDB-style file with coordinates for d1ikfl1.
(The format of our PDB-style files is described here.)

Timeline for d1ikfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikfl2