Lineage for d3qdmd2 (3qdm D:110-196)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517751Domain d3qdmd2: 3qdm D:110-196 [200318]
    Other proteins in same PDB: d3qdma1, d3qdma2, d3qdmb_, d3qdmd1, d3qdme1
    automated match to d1qrnd2

Details for d3qdmd2

PDB Entry: 3qdm (more details), 2.8 Å

PDB Description: The complex between TCR DMF4 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) decameric peptide
PDB Compounds: (D:) DMF4 alpha chain

SCOPe Domain Sequences for d3qdmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdmd2 b.1.1.2 (D:110-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

SCOPe Domain Coordinates for d3qdmd2:

Click to download the PDB-style file with coordinates for d3qdmd2.
(The format of our PDB-style files is described here.)

Timeline for d3qdmd2: