SCOPe 2.08: Domain d3qdmd2: 3qdm D:110-196

Lineage for d3qdmd2 (3qdm D:110-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3qdmd2: 3qdm D:110-196 [200318]
   Other proteins in same PDB: d3qdma1, d3qdma2, d3qdmb1, d3qdmb2, d3qdmd1, d3qdme1
   automated match to d1qrnd2

Details for d3qdmd2

PDB Entry: 3qdm, 2.8 Å

PDB Description: The complex between TCR DMF4 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) decameric peptide

PDB Compounds: (D:) DMF4 alpha chain

SCOPe Domain Sequences for d3qdmd2:

Sequence; same for both SEQRES and ATOM records:

>d3qdmd2 b.1.1.2 (D:110-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Timeline for d3qdmd2:

• d3qdmd2 first appeared in SCOPe 2.03
  
• d3qdmd2 appears in SCOPe 2.07