Lineage for d3qdmd1 (3qdm D:2-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356510Domain d3qdmd1: 3qdm D:2-109 [200317]
    Other proteins in same PDB: d3qdma1, d3qdma2, d3qdmb1, d3qdmb2, d3qdmd2, d3qdme2
    automated match to d1qrnd1

Details for d3qdmd1

PDB Entry: 3qdm (more details), 2.8 Å

PDB Description: The complex between TCR DMF4 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) decameric peptide
PDB Compounds: (D:) DMF4 alpha chain

SCOPe Domain Sequences for d3qdmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdmd1 b.1.1.0 (D:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqspqsmfiqegedvsmnctsssifntwlwykqdpgegpvllialykageltsngrlt
aqfgitrkdsflnisasipsdvgiyfcaggtgnqfyfgtgtsltvipn

SCOPe Domain Coordinates for d3qdmd1:

Click to download the PDB-style file with coordinates for d3qdmd1.
(The format of our PDB-style files is described here.)

Timeline for d3qdmd1: