Lineage for d3qdma1 (3qdm A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937820Domain d3qdma1: 3qdm A:1-181 [200315]
    Other proteins in same PDB: d3qdma2, d3qdmb1, d3qdmb2, d3qdmd1, d3qdmd2, d3qdme1, d3qdme2
    automated match to d1i4fa2

Details for d3qdma1

PDB Entry: 3qdm (more details), 2.8 Å

PDB Description: The complex between TCR DMF4 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) decameric peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3qdma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdma1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3qdma1:

Click to download the PDB-style file with coordinates for d3qdma1.
(The format of our PDB-style files is described here.)

Timeline for d3qdma1: