Lineage for d3qdje1 (3qdj E:4-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519792Domain d3qdje1: 3qdj E:4-117 [200313]
    Other proteins in same PDB: d3qdja1, d3qdja2, d3qdjb_, d3qdjd1, d3qdjd2, d3qdje2
    automated match to d1qrne1

Details for d3qdje1

PDB Entry: 3qdj (more details), 2.3 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(27-35) nonameric peptide
PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qdje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdje1 b.1.1.0 (E:4-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iagitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgev
pdgysvsrantddfpltlasavpsqtsvyfcasslsfgteaffgqgtrltvved

SCOPe Domain Coordinates for d3qdje1:

Click to download the PDB-style file with coordinates for d3qdje1.
(The format of our PDB-style files is described here.)

Timeline for d3qdje1: