![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d3qdjd1: 3qdj D:1-110 [200311] Other proteins in same PDB: d3qdja1, d3qdja2, d3qdjb1, d3qdjb2, d3qdjd2, d3qdje1, d3qdje2 automated match to d1qrnd1 |
PDB Entry: 3qdj (more details), 2.3 Å
SCOPe Domain Sequences for d3qdjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qdjd1 b.1.1.1 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgrf taqlnkasqyvsllirdsqpsdsatylcavnfgggklifgqgtelsvkpn
Timeline for d3qdjd1: