SCOP 1.65: Domain d1fpth1: 1fpt H:1-113

Lineage for d1fpth1 (1fpt H:1-113)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1fpth1: 1fpt H:1-113 [20031]
   Other proteins in same PDB: d1fpth2, d1fptl1, d1fptl2
   part of neutralizing type 1 poliovirus Fab C3

Details for d1fpth1

PDB Entry: 1fpt, 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fpth1:

Sequence; same for both SEQRES and ATOM records:

>d1fpth1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvrpgtsvkvsckasgyaftnyliqwikqrpgqglewigvinpgsggtdy
nanfkgkatltadksssivymqlssltsddsavyfcardfydydvgfdywgqgttltvss

Timeline for d1fpth1:

• d1fpth1 first appeared (with stable ids) in SCOP 1.55
  
• d1fpth1 appears in SCOP 1.63
  
• d1fpth1 appears in SCOP 1.67
  
• d1fpth1 appears in the current release, SCOPe 2.08