SCOP 1.55: Domain d1fpth1: 1fpt H:1-113

Lineage for d1fpth1 (1fpt H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [48797] (1 PDB entry)

8. Domain d1fpth1: 1fpt H:1-113 [20031]
   Other proteins in same PDB: d1fpth2, d1fptl2

Details for d1fpth1

PDB Entry: 1fpt, 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fpth1:

Sequence; same for both SEQRES and ATOM records:

>d1fpth1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
qvqlqqsgaelvrpgtsvkvsckasgyaftnyliqwikqrpgqglewigvinpgsggtdy
nanfkgkatltadksssivymqlssltsddsavyfcardfydydvgfdywgqgttltvss

Timeline for d1fpth1:

• d1fpth1 appears in SCOP 1.57
  
• d1fpth1 appears in the current release, SCOPe 2.08