SCOPe 2.03: Domain d3qdge1: 3qdg E:4-117

Lineage for d3qdge1 (3qdg E:4-117)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3qdge1: 3qdg E:4-117 [200307]
   Other proteins in same PDB: d3qdga1, d3qdga2, d3qdgb_, d3qdgd1, d3qdgd2, d3qdge2
   automated match to d1qrne1

Details for d3qdge1

PDB Entry: 3qdg, 2.69 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) peptide

PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qdge1:

Sequence; same for both SEQRES and ATOM records:

>d3qdge1 b.1.1.0 (E:4-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iagitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgev
pdgysvsrantddfpltlasavpsqtsvyfcasslsfgteaffgqgtrltvved

Timeline for d3qdge1:

• d3qdge1 is new in SCOPe 2.03-stable
  
• d3qdge1 appears in SCOPe 2.04
  
• d3qdge1 appears in the current release, SCOPe 2.08