SCOPe 2.03: Domain d3qdgd2: 3qdg D:111-199

Lineage for d3qdgd2 (3qdg D:111-199)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d3qdgd2: 3qdg D:111-199 [200306]
Other proteins in same PDB: d3qdga1, d3qdga2, d3qdgb_, d3qdgd1, d3qdge1
automated match to d1qrnd2

Details for d3qdgd2

PDB Entry: 3qdg (more details), 2.69 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) peptide

PDB Compounds: (D:) DMF5 alpha chain

SCOPe Domain Sequences for d3qdgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdgd2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3qdgd2:

Click to download the PDB-style file with coordinates for d3qdgd2.
(The format of our PDB-style files is described here.)

Timeline for d3qdgd2: