| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d3qdgd1: 3qdg D:1-110 [200305] Other proteins in same PDB: d3qdga1, d3qdga2, d3qdgb1, d3qdgb2, d3qdgd2, d3qdge1, d3qdge2 automated match to d1qrnd1 |
PDB Entry: 3qdg (more details), 2.69 Å
SCOPe Domain Sequences for d3qdgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qdgd1 b.1.1.1 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavnfgggklifgqgtelsvkpn
Timeline for d3qdgd1: