| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [48797] (1 PDB entry) |
| Domain d1fptl1: 1fpt L:1-108 [20030] Other proteins in same PDB: d1fpth2, d1fptl2 |
PDB Entry: 1fpt (more details), 3 Å
SCOP Domain Sequences for d1fptl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fptl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikr
Timeline for d1fptl1: