SCOP 1.63: Domain d1fptl1: 1fpt L:1-108

Lineage for d1fptl1 (1fpt L:1-108)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [48797] (1 PDB entry)

8. Domain d1fptl1: 1fpt L:1-108 [20030]
   Other proteins in same PDB: d1fpth2, d1fptl2

Details for d1fptl1

PDB Entry: 1fpt, 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fptl1:

Sequence; same for both SEQRES and ATOM records:

>d1fptl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikr

Timeline for d1fptl1:

• d1fptl1 first appeared (with stable ids) in SCOP 1.55
  
• d1fptl1 appears in SCOP 1.61
  
• d1fptl1 appears in SCOP 1.65
  
• d1fptl1 appears in the current release, SCOPe 2.08