| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries) |
| Domain d3q83d_: 3q83 D: [200292] automated match to d3q83f_ |
PDB Entry: 3q83 (more details), 2.5 Å
SCOPe Domain Sequences for d3q83d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q83d_ d.58.6.1 (D:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye
Timeline for d3q83d_: