SCOPe 2.05: Domain d3q83c_: 3q83 C:

Lineage for d3q83c_ (3q83 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries)

8. Domain d3q83c_: 3q83 C: [200291]
   automated match to d3q83f_

Details for d3q83c_

PDB Entry: 3q83, 2.5 Å

PDB Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3q83c_:

Sequence; same for both SEQRES and ATOM records:

>d3q83c_ d.58.6.1 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye

Timeline for d3q83c_:

• d3q83c_ first appeared in SCOPe 2.03
  
• d3q83c_ appears in SCOPe 2.04
  
• d3q83c_ appears in SCOPe 2.06
  
• d3q83c_ appears in the current release, SCOPe 2.08