Lineage for d3q58a1 (3q58 A:1-226)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091243Species Salmonella enterica [TaxId:90370] [196385] (1 PDB entry)
  8. 2091244Domain d3q58a1: 3q58 A:1-226 [200286]
    Other proteins in same PDB: d3q58a2, d3q58b2
    automated match to d3q58b_
    complexed with btb, cl, peg

Details for d3q58a1

PDB Entry: 3q58 (more details), 1.8 Å

PDB Description: Structure of N-acetylmannosamine-6-Phosphate Epimerase from Salmonella enterica
PDB Compounds: (A:) N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d3q58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q58a1 c.1.2.0 (A:1-226) automated matches {Salmonella enterica [TaxId: 90370]}
msllarleqsvhengglivscqpvpgspmdkpeivaamaqaaasagavavriegienlrt
vrphlsvpiigiikrdltgspvritpylqdvdalaqagadiiafdasfrsrpvdidsllt
rirlhgllamadcstvnegischqkgiefigttlsgytgpitpvepdlamvtqlshagcr
viaegryntpalaanaiehgawavtvgsaitriehicqwfshavkr

SCOPe Domain Coordinates for d3q58a1:

Click to download the PDB-style file with coordinates for d3q58a1.
(The format of our PDB-style files is described here.)

Timeline for d3q58a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q58a2