Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (20 species) not a true protein |
Species Salmonella enterica [TaxId:90370] [196385] (1 PDB entry) |
Domain d3q58a_: 3q58 A: [200286] automated match to d3q58b_ complexed with btb, cl, peg |
PDB Entry: 3q58 (more details), 1.8 Å
SCOPe Domain Sequences for d3q58a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q58a_ c.1.2.0 (A:) automated matches {Salmonella enterica [TaxId: 90370]} snamsllarleqsvhengglivscqpvpgspmdkpeivaamaqaaasagavavriegien lrtvrphlsvpiigiikrdltgspvritpylqdvdalaqagadiiafdasfrsrpvdids lltrirlhgllamadcstvnegischqkgiefigttlsgytgpitpvepdlamvtqlsha gcrviaegryntpalaanaiehgawavtvgsaitriehicqwfshavkr
Timeline for d3q58a_: