Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d3pwpe2: 3pwp E:118-246 [200272] Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb1, d3pwpb2, d3pwpd1, d3pwpd2, d3pwpe1 automated match to d1ktke2 complexed with gol, so4 |
PDB Entry: 3pwp (more details), 2.69 Å
SCOPe Domain Sequences for d3pwpe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwpe2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3pwpe2: