Lineage for d3pwpd2 (3pwp D:118-206)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762508Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
  8. 1762529Domain d3pwpd2: 3pwp D:118-206 [200270]
    Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb_, d3pwpd1, d3pwpe1, d3pwpe2
    automated match to d1qsed2
    complexed with gol, so4

Details for d3pwpd2

PDB Entry: 3pwp (more details), 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide
PDB Compounds: (D:) A6 TCR alpha chain

SCOPe Domain Sequences for d3pwpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwpd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3pwpd2:

Click to download the PDB-style file with coordinates for d3pwpd2.
(The format of our PDB-style files is described here.)

Timeline for d3pwpd2: