SCOPe 2.06: Domain d3pwpd1: 3pwp D:1-117

Lineage for d3pwpd1 (3pwp D:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)

8. Domain d3pwpd1: 3pwp D:1-117 [200269]
   Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb1, d3pwpb2, d3pwpd2, d3pwpe1, d3pwpe2
   automated match to d1qsed1
   complexed with gol, so4

Details for d3pwpd1

PDB Entry: 3pwp, 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide

PDB Compounds: (D:) A6 TCR alpha chain

SCOPe Domain Sequences for d3pwpd1:

Sequence; same for both SEQRES and ATOM records:

>d3pwpd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

Timeline for d3pwpd1:

• d3pwpd1 first appeared in SCOPe 2.03
  
• d3pwpd1 appears in SCOPe 2.05
  
• d3pwpd1 appears in SCOPe 2.07
  
• d3pwpd1 appears in the current release, SCOPe 2.08