SCOPe 2.08: Domain d3pwnd1: 3pwn D:1-181

Lineage for d3pwnd1 (3pwn D:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d3pwnd1: 3pwn D:1-181 [200265]
   Other proteins in same PDB: d3pwna2, d3pwnb1, d3pwnb2, d3pwnd2, d3pwne1, d3pwne2
   automated match to d1i4fa2
   complexed with gol

Details for d3pwnd1

PDB Entry: 3pwn, 1.6 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the HuD (G2L) peptide variant

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwnd1:

Sequence; same for both SEQRES and ATOM records:

>d3pwnd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3pwnd1:

• d3pwnd1 first appeared in SCOPe 2.03
  
• d3pwnd1 appears in SCOPe 2.07