Lineage for d3pwla1 (3pwl A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937701Domain d3pwla1: 3pwl A:1-181 [200259]
    Other proteins in same PDB: d3pwla2, d3pwlb1, d3pwlb2, d3pwld2, d3pwle1, d3pwle2
    automated match to d1i4fa2
    complexed with gol

Details for d3pwla1

PDB Entry: 3pwl (more details), 1.65 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the HuD peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwla1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3pwla1:

Click to download the PDB-style file with coordinates for d3pwla1.
(The format of our PDB-style files is described here.)

Timeline for d3pwla1: