Lineage for d3pwjd2 (3pwj D:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2746876Domain d3pwjd2: 3pwj D:182-275 [200258]
    Other proteins in same PDB: d3pwja1, d3pwjb1, d3pwjb2, d3pwjd1, d3pwje1, d3pwje2
    automated match to d1i4fa1
    complexed with gol

Details for d3pwjd2

PDB Entry: 3pwj (more details), 1.7 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the HuD (G2L,I9V) peptide variant
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwjd2 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d3pwjd2:

Click to download the PDB-style file with coordinates for d3pwjd2.
(The format of our PDB-style files is described here.)

Timeline for d3pwjd2: