SCOPe 2.03: Domain d3puxb1: 3pux B:2-235

Lineage for d3puxb1 (3pux B:2-235)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (13 PDB entries)

8. Domain d3puxb1: 3pux B:2-235 [200245]
   Other proteins in same PDB: d3puxa2, d3puxb2, d3puxe_, d3puxf1, d3puxf2, d3puxg_
   automated match to d1q12a2
   complexed with adp, bef, mal, mg, pgv, umq

Details for d3puxb1

PDB Entry: 3pux, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3puxb1:

Sequence; same for both SEQRES and ATOM records:

>d3puxb1 c.37.1.12 (B:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d3puxb1:

• d3puxb1 is new in SCOPe 2.03-stable
  
• d3puxb1 appears in SCOPe 2.04
  
• d3puxb1 appears in the current release, SCOPe 2.08